NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005572

3300005572: Marine microbial communities from the Deep Atlantic Ocean - MP0139 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300005572 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054875 | Ga0005500
Sample NameMarine microbial communities from the Deep Atlantic Ocean - MP0139 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size63352589
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)14.311Long. (o)-26.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013050Metagenome / Metatranscriptome275Y
F103104Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0005500_1043217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1980Open in IMG/M
Ga0005500_1159293Not Available650Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0005500_1043217Ga0005500_10432173F013050MSKGKQPRTRVKVPKLLLSETKEVFFKYNQEIGLEAAIF*
Ga0005500_1159293Ga0005500_11592931F103104FGIPSGCPSTNLVFTKSITLPKDSVVYATGHIITKQKGGRADLYLKINNGMRDYALSEDSTGQWVDLTVNHATTLKKGKYTFQISSNKNARFGCGAGWGDLDIVVVPKFKGVAAYNQPDTKSGCPAKRAANTDLILKTIKVDQTSIIKVTGHIIRTFSGRADAYLKYQRKTNLDTSLTYTNNRRWEDVKLHWTGRLGKGTHTFSIQSNKANAFGCG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.