Sample 3300005479

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005479

3300005479: Activated sludge microbial communities from EBPR reactors in the US and Australia - sample from Queensland, Australia

Overview

Basic Information
IMG/M Taxon OID	3300005479 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0045009 \| Gp0051192 \| Ga0074232
Sample Name	Activated sludge microbial communities from EBPR reactors in the US and Australia - sample from Queensland, Australia
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	26490200
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Activated Sludge Microbial Communities From Ebpr Reactors In The Us And Australia
Type	Engineered
Taxonomy	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Microbial Communities From Ebpr Reactors In The Us And Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Austrailia: Brisbane, Queensland
Coordinates	Lat. (^o)	-27.4872	Long. (^o)	153.1974	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104545	Metagenome / Metatranscriptome	100	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0074232_109726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	985	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074232_109726	Ga0074232_1097261	F104545	GVSTEVLPRMTAKGVRVGKDQPIRTCTAQHARQRIVGQQAGIDCDAATKAVRVPTGSGQPDVEPVDTILRPVGRRKTFRDVPASIGRVRQRLEMARVPKPFQHTVIKVAVQKSDR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.