NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004567

3300004567: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 9_HOW4 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004567 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114290 | Gp0111159 | Ga0066495
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 9_HOW4 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17436489
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available4
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas alcaligenes1
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biome → freshwater lake → lake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000344Metagenome / Metatranscriptome1257Y
F014854Metagenome / Metatranscriptome259Y
F041780Metagenome / Metatranscriptome159Y
F082737Metagenome / Metatranscriptome113Y
F092248Metagenome / Metatranscriptome107Y
F094695Metagenome / Metatranscriptome105Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066495_100524Not Available570Open in IMG/M
Ga0066495_108197All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas alcaligenes637Open in IMG/M
Ga0066495_112065Not Available584Open in IMG/M
Ga0066495_143752Not Available673Open in IMG/M
Ga0066495_147461All Organisms → cellular organisms → Eukaryota505Open in IMG/M
Ga0066495_147797Not Available550Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066495_100524Ga0066495_1005241F082737*PSLQLAPQPACQV*ACHIQHAGRCPRLAPRPRCFSVGASMLGGPPASLPVRSQNLETDFHSPTKTNLLPDRRGGVRVPALPLQLCGTLAVSPVRSDLHPRPVSRTAWDFYDQNPLLPDPAPLLPASLNRRSPLGFFAPPDQSARSRWPTGNLLSATPDLPSLPTGGRIRYQHQRIIVPAPLRLCQLAV
Ga0066495_108197Ga0066495_1081971F014854SRMIPGNWGKVESGWLARPLLDRIARFGGGGRIHQFLWSRSHAVSYAKRNLAARGDKKPLRVGSSSSGRFRAWANRSYPEGKWLLLCIGTGRVTLADSINRLKPPNESHRKVDKGSARTGKITQARQAA*
Ga0066495_112065Ga0066495_1120652F000344MRPKHPPAAESGVGKHTARESERAQSCATGKERVANAHPQIW
Ga0066495_143752Ga0066495_1437522F094695SCSPLQRCQLLDGGISVCSVRDPCFRETWDDVQRFSDESIGSSWVQPSTVRRSPFPVASFRDSLSAVVRRFSRPRHSSLRLTCLLEALPPINRPRMRTREHLSYGFVPYSAQQKQASVSPGASNLRHCPSSGFLTLSTSCSACNPDQFVSPGLRSWGSTKSVYSPPSFDEGRVRRAWVSSPKLSPFP*
Ga0066495_147461Ga0066495_1474611F092248LKLK*IDGGPHKRLSDKVYLTSHSWIKSSHSPEGSPDHSKSVGATGGVYKGQGRNQRSLMTNAY*
Ga0066495_147797Ga0066495_1477971F041780*P*VAACSPTGMHGQNTAF*MTGLNSLCSPRPPFGGSASTLWAQPARHSNRNRNLETAFLLTCGDFPYPELRDKLKRSQPASSISLPCPIRIRSVLNSLPDAFGFRRGHGHKTRFPLAARQSRPILEPPLPFRVSPPPDHNAQSDSDREVYLGKTPDIPLLPERINE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.