NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003969

3300003969: Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39861



Overview

Basic Information
IMG/M Taxon OID3300003969 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0113966 | Gp0109823 | Ga0063589
Sample NameEnrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39861
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Michigan
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size61068471
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHarmful Algal Blooms In Lake Erie
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomeglacial lakemicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationLake Fryxell, Antarctica
CoordinatesLat. (o)-77.611214Long. (o)163.119356Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097196Metagenome / Metatranscriptome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0063589_102839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2359Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0063589_102839Ga0063589_1028393F097196MLTMSKPPISFRLSEDELILLESNQQPGESLSLTAARLLRKQLGVVDGVVDKLETKTSNHLIQDRMDELKSDVNSYVNNRVNELLVRIEALEVKPKTTTRRSTSKVTPKDLEVQS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.