Sample 3300003969

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003969

3300003969: Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39861

Overview

Basic Information
IMG/M Taxon OID	3300003969 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0113966 \| Gp0109823 \| Ga0063589
Sample Name	Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39861
Sequencing Status	Permanent Draft
Sequencing Center	University of Michigan
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	61068471
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Harmful Algal Blooms In Lake Erie
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater lake biome → glacial lake → microbial mat material
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Lake Fryxell, Antarctica
Coordinates	Lat. (^o)	-77.611214	Long. (^o)	163.119356	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097196	Metagenome / Metatranscriptome	104	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0063589_102839	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2359	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0063589_102839	Ga0063589_1028393	F097196	MLTMSKPPISFRLSEDELILLESNQQPGESLSLTAARLLRKQLGVVDGVVDKLETKTSNHLIQDRMDELKSDVNSYVNNRVNELLVRIEALEVKPKTTTRRSTSKVTPKDLEVQS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.