| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003948 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111355 | Gp0109928 | Ga0064031 |
| Sample Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS907_80_12L9 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Marine Biological Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1078867 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Anemone diffuse flow vent, Axial seamount | |||||||
| Coordinates | Lat. (o) | 45.933 | Long. (o) | -130.014 | Alt. (m) | N/A | Depth (m) | 1542 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010914 | Metagenome / Metatranscriptome | 297 | Y |
| F042865 | Metagenome / Metatranscriptome | 157 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0064031_10958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| Ga0064031_11234 | Not Available | 573 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0064031_10958 | Ga0064031_109582 | F010914 | MIYNILVEQNGKFVDSGETVECEFEETQAVIDELQAEHGCCCALEAVSE* |
| Ga0064031_11234 | Ga0064031_112341 | F042865 | MALRVPDYETFLAADDFNKRIWWSFMQSVVNDLPLNGNVAPENIVRANKSCLYVESTGGTAVLWFNPNGNGSATGWIVK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |