NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003866

3300003866: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_30_12H



Overview

Basic Information
IMG/M Taxon OID3300003866 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111355 | Gp0109399 | Ga0062496
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_30_12H
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6664332
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium → Chromobacterium phragmitis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 33 diffuse flow vent, Axial Seamount
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)N/ADepth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025488Metagenome / Metatranscriptome201N
F051069Metagenome / Metatranscriptome144N
F076004Metagenome / Metatranscriptome118N
F078696Metagenome / Metatranscriptome116N
F087089Metagenome / Metatranscriptome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0062496_102166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales691Open in IMG/M
Ga0062496_104385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae525Open in IMG/M
Ga0062496_105241All Organisms → cellular organisms → Bacteria → Proteobacteria959Open in IMG/M
Ga0062496_106456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium → Chromobacterium phragmitis952Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0062496_102166Ga0062496_1021662F051069MAYRVSISSTELVTRAEVVAYAKIENTDENTIIDALITSSREELENLLKIPLITQVWAQTYDSFIEAVYAPFIPLTSAALEIADSDGNFSANTYISVKKDTGRIAPTDVFSPSLQFDGFKITFTYTVSAIDAALKTAIMELTSYRFYNR
Ga0062496_102679Ga0062496_1026792F025488MAYVSRGFIPQTSLAANLGFTRPMYIPAGNGTATALYDIVKVSTSGSTVDTAGVPAGLMGCVRVSDKDDVPCGVIVGFIADPDYLNQTYRSASTARVALVNYDPQVVLEAQEDDNGTTLAVARIGTPVDLVPGSIDTVTGTSGMQISSATLAGSPGMFRLQQRSFAVDNAAIAGTNTKWLVTFNTHQFKATA*
Ga0062496_104385Ga0062496_1043852F078696MKLWSSAVTYLNVQPSEAWNLTPFEFWALWDTHLEKMEISTGKAYTRPMTMDEFNELSDFLDKLHGDN*
Ga0062496_105241Ga0062496_1052411F087089DTFIASKSRLADSQFIVKMAQDSPQFKTSLRGALAEKVAGLNNAKMIEFIENKANRELIKGIFGDTVLKKFDRVLVDAKRDRLGSTLGGVGGSQTYGRGATDKIMSQSIWKLDGAGASLGALLGTMLGGVGTMGGALGGAATAHGVKVLNMKQNALTSKAMLDPKYAAELLKKQIAPTQYKHGALGTSALREYMRNQDEQGGQ*
Ga0062496_106456Ga0062496_1064562F076004MDTENTVALSNRNGIQTFVQNVEFDRDGRHYDEPCLLMCRGFMGVKNMFVFPLCDAWTVREPDFFKATMQDAAATLFVSPTKNDEHVIGDMILHDIDTIIAWRPDDDATHDHALMKKEVERTGMFLQVNGQTLVDAR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.