Basic Information | |
---|---|
IMG/M Taxon OID | 3300003811 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110170 | Gp0088264 | Ga0007802 |
Sample Name | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA4M |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 18489198 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Crystal Bog, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 46.0072 | Long. (o) | -89.6063 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024742 | Metagenome / Metatranscriptome | 204 | Y |
F088507 | Metagenome / Metatranscriptome | 109 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0007802_103282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0007802_103282 | Ga0007802_1032822 | F088507 | MTNCCNANGECTQGRDCPIRKQRAQEANDAFMNRNNGLEPDLIDDLAASVKGLIALVCVATGVAMIAFAFWGK* |
Ga0007802_103282 | Ga0007802_1032823 | F024742 | MNNETQRIMEALMLIYGSDLQAATITVLLKDGDTAVRYLSSTFPQKEKQDDTN* |
⦗Top⦘ |