NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003811

3300003811: Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA4M



Overview

Basic Information
IMG/M Taxon OID3300003811 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110170 | Gp0088264 | Ga0007802
Sample NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA4M
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size18489198
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024742Metagenome / Metatranscriptome204Y
F088507Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0007802_103282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0007802_103282Ga0007802_1032822F088507MTNCCNANGECTQGRDCPIRKQRAQEANDAFMNRNNGLEPDLIDDLAASVKGLIALVCVATGVAMIAFAFWGK*
Ga0007802_103282Ga0007802_1032823F024742MNNETQRIMEALMLIYGSDLQAATITVLLKDGDTAVRYLSSTFPQKEKQDDTN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.