| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003745 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111355 | Gp0109402 | Ga0062506 |
| Sample Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_30_13H |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Marine Biological Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3756743 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas paralcaligenes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Marker 33 diffuse flow vent, Axial Seamount | |||||||
| Coordinates | Lat. (o) | 45.9332 | Long. (o) | -129.982268 | Alt. (m) | N/A | Depth (m) | 1516 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074867 | Metagenome / Metatranscriptome | 119 | N |
| F078696 | Metagenome / Metatranscriptome | 116 | N |
| F091607 | Metagenome / Metatranscriptome | 107 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0062506_103046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae | 773 | Open in IMG/M |
| Ga0062506_105590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas paralcaligenes | 602 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0062506_103046 | Ga0062506_1030461 | F074867 | MSSRGITDIYLNGEAFELHPTFSNLDKLETVLNKGAIGFLRQDLSSGAFKTGDVVSIIQVCAVPANGRKFPNWWNRDGVGDAVIGAGLVGITTSVTHFLAKALTAGTETDIKTVGSESDEKK* |
| Ga0062506_103046 | Ga0062506_1030462 | F078696 | MKLWSSAVTYLNVQPSEAWNLTPFEFWALWDTHLEKMEISTGKAYTRPMTMDEFNELDAYLDELHGDN* |
| Ga0062506_105590 | Ga0062506_1055902 | F091607 | MSLELQISELNATIKTLNENILLLLGSKQTTITTATPTPTPVNLCQTEQQTFLPYVAKSDEYTREQLQSLCLEATKRNAANRDIIKAIMLSNFEARKTGDLADNQINLCYSMIAQATKDD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |