NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003742

3300003742: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_80_13L



Overview

Basic Information
IMG/M Taxon OID3300003742 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111355 | Gp0109411 | Ga0062515
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_80_13L
Sequencing StatusPermanent Draft
Sequencing CenterThe Marine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1474619
Sequencing Scaffolds4
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 33 diffuse flow vent, Axial Seamount
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)N/ADepth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010914Metagenome / Metatranscriptome297Y
F025488Metagenome / Metatranscriptome201N
F042865Metagenome / Metatranscriptome157N
F051872Metagenome / Metatranscriptome143N
F082613Metagenome / Metatranscriptome113N
F101016Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0062515_10187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae1203Open in IMG/M
Ga0062515_10780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria972Open in IMG/M
Ga0062515_11130Not Available717Open in IMG/M
Ga0062515_11679Not Available806Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0062515_10187Ga0062515_101872F082613MRPCHYSYTPEAAATNSISLSQAVVGAAALTQTGTYGVNGFPSELAWNITITSSANISGVNLTIVYLDAQLNQQSIVVAGPNATTKDAGIYATKIISVTTSASDSNILIGHTNVGFAPWKVIPSRGVSSTTGASIGIDGTANITLQTTFANIADNAIFAGTFDVFSHSYLAALTASAFDTVDTREIGVRLKFNSWSSGNVRLDLSVSAKG*
Ga0062515_10511Ga0062515_105111F025488MAYVSRGFIPQTSLASNLGFTRPMYIPAGNATATALYDIVKVSTSGSTVDTAGVPAGLMGCVRVSDKDDVPCGVIVGFIADPDYLNQTCRSASTARVALVNYDPQVVLEAQEDDNGTTLAVARIGTPVDLVPGSIDTVTGTSGMQISSATLAGSPGMFRLQQRSFAVDNAEIAGTNTKWL
Ga0062515_10780Ga0062515_107802F010914MIYNILVEQNGKFVTTGETVDCEFEETQAVIDELQLEHGCCCALEAVSE*
Ga0062515_11130Ga0062515_111301F051872TTADKAKALGWNPDKDEFKAKTGKEWSTAGQYLRQREMADEIHKRGQELKQLRRDMDRRLKNVEQPIANIAQNEHKQRLDNVSLSLKQAAIDQDFDAIDALLAERDKLLKAEPVAKQEEPLAIDDTNDDGETQEQLQAAAQKWIADNPWYNKLTQAGRDQAAKLEAEYRAKVDCTTEEALAYVAQEMGKDPIVAVLKGKLKSPDVTPRTAERPRVASASESSLDPASRNIYNKMISQG
Ga0062515_11239Ga0062515_112391F101016DVEVMYNDAQKRQADQLLEELTALPAAIPTSEELMNEQSIDSGEGQQGGLPPMVEQSSDQGDDGAIDQRVDEPQQPNEPPQSIDIGEGTLPIGQGAGIDGGVGLQEPANGDMQEGV*
Ga0062515_11679Ga0062515_116791F042865MSLRVPDYETFLAADDFNKRIWWSFMQSVVNDLPLNGNVAPENTIRANKSCLYVESTGGTAVLWFNPNGNGSATGWIVK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.