NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003741

3300003741: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_55_12L



Overview

Basic Information
IMG/M Taxon OID3300003741 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0109405 | Ga0062509
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_55_12L
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1764119
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 33 diffuse flow vent, Axial Seamount
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)N/ADepth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046373Metagenome / Metatranscriptome151Y
F051069Metagenome / Metatranscriptome144N
F054846Metagenome / Metatranscriptome139N
F091607Metagenome / Metatranscriptome107N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0062509_10851Not Available676Open in IMG/M
Ga0062509_11152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli583Open in IMG/M
Ga0062509_11362Not Available1043Open in IMG/M
Ga0062509_11968All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila524Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0062509_10851Ga0062509_108512F091607MSLETQISELNATIKTLNENILLLLGSKEQHSKVECSPVEPANLGQTEQQTFLPEVAKSDEYTREQLQSLCLEATKRNAANRDIIKAIMLSNFEARKTGDLADNQINLCYSMIA
Ga0062509_11152Ga0062509_111521F051069IDALITSSREELENLLKIPLITQVWAQTYDSFIEQVYAPFIPLTSAALEIADSDGNFSANTYISVKKDTGRIAPTDVFSPSLQFDGFKITFTYTVSAIDAALKTAIMELTSYRFYNRGNLETAKIPASVLSMVGHLRVFSV*
Ga0062509_11362Ga0062509_113621F054846MPRRGAEGRGQSRESRKSLSEHDTARKPERVPMYAQRTMIDTTLIPEGFHGHWVSNNPAGRIDMLLRAGYDFVTKDQNVYSSHVTENGVDSRVSKSGSDGVTLYLMIIPLELYEADQEAKAEKAKEQTATIFGKQRNDPDFFSRDENGRDTPASRGIGRVTTNDFVL*
Ga0062509_11968Ga0062509_119682F046373SMINSFIANTHCFVVAHNNVDDYRICELGEGNELSSLLPHFEQFDTYELALARVPVEFRPDDEQL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.