NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003731

3300003731: Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C49A8_80 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300003731 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0099541 | Gp0061256 | Ga0006240
Sample NameAmmonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C49A8_80 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size4921626
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomeintertidal zonesea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationMonterey Bay, California, USA
CoordinatesLat. (o)35.7899Long. (o)-122.3199Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098669Metagenome / Metatranscriptome103N
F099150Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0006240_100041Not Available508Open in IMG/M
Ga0006240_103387All Organisms → cellular organisms → Eukaryota1115Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0006240_100041Ga0006240_1000411F098669METATRGRKQKWRLKEAEGLGRKQRIEEAERRELHESDQGLDSGHGLNPGRKVRRIDQTMEGSPEIVPAKIRKKP
Ga0006240_103387Ga0006240_1033871F099150MKAAILACVLLGLSASAYAEEFEVADESNARFLYFNTSSTATSLTLLGALILLGVIGYLVYVGGLLGTSSYNRNDYYDAAAYDQQYANAYAQQAQYRSDDTKSPFNVMQILEGIEMLKNIYESTRS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.