| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003729 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063445 | Gp0056835 | Ga0006123 |
| Sample Name | Soil microbial communities from Colorado Plateau, Utah, USA - Soil Crust after wet up 3C (Custom Analysis) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 12179898 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | desert biome → desert → soil biocrust |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Colorado Plateau and Sonoran desert | |||||||
| Coordinates | Lat. (o) | 38.42 | Long. (o) | -109.4099 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041063 | Metagenome / Metatranscriptome | 160 | Y |
| F059546 | Metagenome / Metatranscriptome | 133 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0006123_100556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 521 | Open in IMG/M |
| Ga0006123_102800 | Not Available | 506 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0006123_100556 | Ga0006123_1005561 | F059546 | LKKMMMLAALLAMLVVAAIPAIAQVEQGFEQETDSGEVEQSFEISGSGDNGNQCANVNGTTNTGNLQNQSGSIQYASDIEEFEQEEIGSDLSVTGTGSVTCEQQVNQAAAAG* |
| Ga0006123_102800 | Ga0006123_1028001 | F041063 | ERLASSGRGAACLVDLGLGVRVAEGKVTMSRISYKRLGAALISLSVPFMMAGPVAAQPEAAEVASVELACLALGFDVNTCTFAVREGVYDVVEDVVNADLGDQGLAYVVDVGEEVGEEPGEFGADINEIAINPLPPVAATGEVLLPPSAVLE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |