NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003549

3300003549: Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_08_M0_20 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300003549 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0099541 | Gp0089009 | Ga0008452
Sample NameAmmonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_08_M0_20 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10680225
Sequencing Scaffolds10
Novel Protein Genes11
Associated Families11

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available5
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → intertidal zone → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationMonterey Bay, California, USA
CoordinatesLat. (o)36.25Long. (o)-122.2099Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001488Metagenome / Metatranscriptome686Y
F015413Metagenome / Metatranscriptome255Y
F019484Metagenome / Metatranscriptome229Y
F019658Metagenome / Metatranscriptome228Y
F027998Metagenome / Metatranscriptome193Y
F046638Metagenome / Metatranscriptome151Y
F059360Metagenome / Metatranscriptome134Y
F085780Metagenome / Metatranscriptome111Y
F093912Metagenome / Metatranscriptome106Y
F098669Metagenome / Metatranscriptome103N
F101265Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0008452J51689_100029Not Available509Open in IMG/M
Ga0008452J51689_100386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1182Open in IMG/M
Ga0008452J51689_100497Not Available1768Open in IMG/M
Ga0008452J51689_102556Not Available550Open in IMG/M
Ga0008452J51689_104658Not Available1322Open in IMG/M
Ga0008452J51689_106407Not Available615Open in IMG/M
Ga0008452J51689_106882All Organisms → cellular organisms → Bacteria1588Open in IMG/M
Ga0008452J51689_106933All Organisms → cellular organisms → Bacteria611Open in IMG/M
Ga0008452J51689_111759All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens854Open in IMG/M
Ga0008452J51689_111917All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales751Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0008452J51689_100029Ga0008452J51689_1000292F098669METATRGRKQKWRLKEAEGLGRKRRIGEAEGREPHESDQGLDSGPGLNPGRKVRRIDQAMEGSPEIVPAKIRKKP
Ga0008452J51689_100386Ga0008452J51689_1003862F059360MTLFKEVLVPANLVPAAAVIREGQALSVITGRTESVDCNISYMLKFKA*
Ga0008452J51689_100497Ga0008452J51689_1004972F019484PNTMYSFFYFLTILGGSLKKIAKKITTNVPISKKVYTNASII*
Ga0008452J51689_102556Ga0008452J51689_1025561F101265GGNKISGLKLATDLRLKRTYHCRITDVGQDYDLRIIISKSIGVYIVKTTS*
Ga0008452J51689_104658Ga0008452J51689_1046582F085780MRSKLKSLKIVQVLPNGCVHFDHLVYLKTYTRYNFSKKSLFFSLLDKKKLFFENSNFFYKKYR
Ga0008452J51689_106407Ga0008452J51689_1064071F015413LESTELEKQVNDLLNTKFEQPEFEQLLPKGLLGKDMLIGSAGTALAVQMGNIVGKFLPIGQLPSGTSSILAGVLMQKFLGKNGNLKKLSEGIIQGGIATAMTPFVSGLIPAQFQQVEKQVETATEPINPTMQGVMW*
Ga0008452J51689_106882Ga0008452J51689_1068823F019658MKASKIKNQNYKLFKYNLLKLQIYSNQYTFTLNKFSNSMLEQIEAYLKQVLKIIFEYHV*QFKILFIGFPVICKMKQMKLIHFTNHNFIPEKS*VSGVFRNRLSILTYLNLIQSQSFSKSLKLLLTIKTKPHLVVVFNQKVEHSTINEFYKAGIPILSFN*NSFDRFKIAYQTLGNFNFIERNIKLTFFFLFYSLLKKTPLTKRL
Ga0008452J51689_106933Ga0008452J51689_1069333F027998DELTNTRAAEIGITTITTANITLLKNALNEGVILITDLTF*
Ga0008452J51689_111759Ga0008452J51689_1117591F001488VSLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
Ga0008452J51689_111917Ga0008452J51689_1119171F046638LMIKTLKNSIFKNLVVLIHGPIILLNNPNKKLTFKELESINPFISLLGFRLNNKIYSRKQIKNLKKMSYIENISIFHNSIKTFTKLPY*
Ga0008452J51689_111917Ga0008452J51689_1119174F093912FFYSAGMFSLQKRQKTRQPKAIITILRALLSKSKSFKIKPVAVHFNNLFFNHQSYIFKKLKQKVFIKLVTSYSYRPHNGCRLKKKKRIKIRTRTRKL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.