NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003421

3300003421: Upper troposphere microbial communities - SEAC4RS-RF10-011



Overview

Basic Information
IMG/M Taxon OID3300003421 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110167 | Gp0085220 | Ga0007666
Sample NameUpper troposphere microbial communities - SEAC4RS-RF10-011
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1979669
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
Not Available3
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationUSA and various oceans
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032247Metagenome / Metatranscriptome180Y
F043390Metagenome / Metatranscriptome156N
F050360Metagenome / Metatranscriptome145Y
F054846Metagenome / Metatranscriptome139N
F055725Metagenome / Metatranscriptome138Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25855J50184_10037All Organisms → Viruses → Predicted Viral1519Open in IMG/M
JGI25855J50184_10159Not Available723Open in IMG/M
JGI25855J50184_10234Not Available615Open in IMG/M
JGI25855J50184_10241All Organisms → cellular organisms → Bacteria612Open in IMG/M
JGI25855J50184_10291Not Available562Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25855J50184_10037JGI25855J50184_100372F043390MSYQVKTEDLQKVISLTLTAEQLETIAGALELYCIGLAEHNDPHLKYAADAQDAIIDVLESIFSVEE*
JGI25855J50184_10159JGI25855J50184_101592F050360MQKMTNSYDNWFQDMLRDCENGLFGGDVHDESKDDVSDWTDVKTYLPEFSRMVWAAVPNVIICAHQTFLLYLDSDGQWRDNTGCLFGRRVNFWQYAEVPFFEGSC*
JGI25855J50184_10234JGI25855J50184_102341F054846AEGRGQSRESRKSLSEHDTARKPERVPMYSQRTMIDTTLIPEGYHGHWVSNNPAGRIDMLLRAGYDFVTKDQNVYSSHVTENGVDSRVSKSGSDGVTLYLMIIPLELYEADQEAKAEKAKEQTATIFGKQRNDPDFFSRDENGRDTPASRGIGRVTTNDFVL*
JGI25855J50184_10241JGI25855J50184_102411F032247ILRSNAMTIDDAIYNLEAYGRHMGNRFIAINHDRSYELLLKNAVIILEYAGMIERDTVKAWAHCNVRIINRDAERVDYTTGL*
JGI25855J50184_10291JGI25855J50184_102911F055725LNSMSKMTGHSKNGIKAALERNNIPYTMGIRECFITVDGVLTSLGDACNAQGFSRESMYAWRVKRGLNEQDGFDAYIIYQQSKRTIDKPILTFKNTTVIYKKERYTLDAISDKLKLNKQRFXVFMRHNRYGQNAFERYCWTRGL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.