NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003326

3300003326: Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-5-R (Metagenome Metatranscriptome, Counting Only)



Overview

Basic Information
IMG/M Taxon OID3300003326 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110114 | Gp0061324 | Ga0006575
Sample NameIonic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-5-R (Metagenome Metatranscriptome, Counting Only)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20816934
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameIonic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationJoint BioEnergy Institute, California, USA
CoordinatesLat. (o)38.5402Long. (o)-121.75Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003289Metagenome / Metatranscriptome495Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0006575J49615_108064Not Available550Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0006575J49615_108064Ga0006575J49615_1080641F003289GNVTIEANLQSNFNIGFTNTKTDILIHLTQ*QY*W*F*FSFLWAFYYLTILKIVRFRTLKFRPRIATTLRPHGK*GDLIICIIPVS*CANIISNSNFILRMIE*QSEASLLTVRIRGKQWY*VYKFELKTFTDVLTVPKNIGRNK*QISTPGDLQVADDYLHILQLRAQNK*VKNY*SDMVKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.