Sample 3300003136

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003136

3300003136: Marine microbial communities from the Lost City Hydrothermal Field

Overview

Basic Information
IMG/M Taxon OID	3300003136 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0062049 \| Gp0052121 \| Ga0051099
Sample Name	Marine microbial communities from the Lost City Hydrothermal Field
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	24827591
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities From The Lost City Hydrothermal Field
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From The Lost City Hydrothermal Field

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Lost City Hydrothermal Field, Atlantic Ocean
Coordinates	Lat. (^o)	30.12	Long. (^o)	-42.12	Alt. (m)	N/A	Depth (m)	731
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079616	Metagenome	115	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0051099_113111	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	754	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0051099_113111	Ga0051099_1131111	F079616	ARRYWYKLGGLKKDEMYTVVGFNPYDKGLILKEVKSPGSGYNAFAAERFRKVDYEFAKKTIQELDTQHSY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.