NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002767

3300002767: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS1_TP1_13L



Overview

Basic Information
IMG/M Taxon OID3300002767 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0095193 | Ga0047374
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS1_TP1_13L
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size921200
Sequencing Scaffolds0
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 113, Axial Seamount, Northeast Pacific Ocean
CoordinatesLat. (o)45.922741Long. (o)-129.988104Alt. (m)N/ADepth (m)1522
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025488Metagenome / Metatranscriptome201N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link

Sequences

Scaffold IDProtein IDFamilySequence
LVWS1TP113L_11191LVWS1TP113L_111912F025488MAYVSRGFIPQTSLASNLGFTRPMYIPAGNGTATALYDIVKVSTSGSTVDTAGVPAGLMGCVRVSDKDDVPCGVIVGFIADPDCLNQTYRSASTARVALVNYDPQVVLEAQEDDNGTTLAVARIGTPVDLVPGSIDTVTGTSGMQISSATLAGSPGMFRLQQRSFAVDNAAIAGTNTKWLVTFNTHQFKATA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.