x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300002695
3300002695: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline
Overview
| Basic Information |
| IMG/M Taxon OID | 3300002695 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0047444 | Gp0091716 | Ga0024847 |
| Sample Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline |
| Sequencing Status | Permanent Draft |
| Sequencing Center | McGill University |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 18136085 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information |
| Location | Fort McMurray, Alberta, Canda |
| Coordinates | Lat. (o) | 55.07 | Long. (o) | -110.53 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F079376 | Metagenome / Metatranscriptome | 116 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| draft_107556 | draft_1075562 | F079376 | PCVSFGVSRVCRTTEKGERQMRHRESDSLVVPVKAGNAAGGKEATHGSVV* |
