x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300002534
3300002534: Coal-degrading lab enrichment microbial communities from Bowden, Alberta, Canada- methanogenic culture: QSAFCN2
Overview
Basic Information
IMG/M Taxon OID 3300002534 Open in IMG/M GOLD Reference Gs0047444 | Gp0054483 | Ga0009256 Sample Name Coal-degrading lab enrichment microbial communities from Bowden, Alberta, Canada- methanogenic culture: QSAFCN2 Sequencing Status Permanent Draft Sequencing Center McGill University Published? Y Use Policy Open
Dataset Contents
Total Genome Size 42978460 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → FCB group 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Hydrocarbon Resource Environments Microbial Communities From Canada And Usa Type Engineered Taxonomy Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
Location Information
Location Bowden, Alberta, Canada Coordinates Lat. (o ) 51.9740275 Long. (o ) -113.8051889 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F069913 Metagenome / Metatranscriptome 123 Y
Sequences
Scaffold ID Protein ID Family Sequence
QSAF_1001077 Draft06538 F069913 LTGEEYNLLEEELINSGLDNKSFLTSRWIKLHKYYYWKRKSRDLKEDSLQAEGQFLPIDVHSGGLIKPSKRGKGLKQRFITRGEIEIELRTPSGAELRIRGIMDSLMVSTIIASTGGRRNV*
