Sample 3300002468

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300002468

3300002468: Deep subsurface microbial communities from Mt. Terri Underground Rock Laboratory, Switzerland - 10_samples_coassembly

Overview

Basic Information
IMG/M Taxon OID	3300002468 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0110172 \| Gp0088957 \| Ga0023001
Sample Name	Deep subsurface microbial communities from Mt. Terri Underground Rock Laboratory, Switzerland - 10_samples_coassembly
Sequencing Status	Permanent Draft
Sequencing Center
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	143773111
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing
Type	Environmental
Taxonomy	Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → planetary subsurface zone → clay soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Mt. Terri, Switzerland
Coordinates	Lat. (^o)	47.379	Long. (^o)	7.1648	Alt. (m)	N/A	Depth (m)	300
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079376	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
BRHa_1006102	All Organisms → cellular organisms → Bacteria	17187	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
BRHa_1006102	BRHa_100610222	F079376	MFDIVIRREPGRPCASFGVSRVCRTTEEGGRQMRHRESDSLVVPMKAGNAAGGKEATHGSAV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.