Sample 3300002096

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300002096

3300002096: Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2

Overview

Basic Information
IMG/M Taxon OID	3300002096 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053054 \| Gp0056925 \| Ga0005063
Sample Name	Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	121439435
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Soil Microbial Communities From Rifle, Colorado, Usa
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater biome → planetary subsurface zone → groundwater
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	USA: Rifle, Colorado
Coordinates	Lat. (^o)	39.53	Long. (^o)	-107.78	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073159	Metagenome / Metatranscriptome	120	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
C687J26661_1004993	All Organisms → cellular organisms → Bacteria	2231	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
C687J26661_1004993	C687J26661_10049932	F073159	MARRKKHAVRSGAGSMCNICGRNCGKGGALRTHIEGAHKVSYDAYKTCFYGDVKTQIADTWDDSVKTHGGQTVITHVLVRRFIGNPGERGVRRKVP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.