| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002094 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0056926 | Ga0005064 |
| Sample Name | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 63701458 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Rifle, Colorado, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Rifle, Colorado, United States | |||||||
| Coordinates | Lat. (o) | 39.53 | Long. (o) | -107.78 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050966 | Metagenome / Metatranscriptome | 144 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C687J26610_1002148 | Not Available | 2012 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C687J26610_1002148 | C687J26610_10021481 | F050966 | MSGSMWQGMKTRHGDGTEALSEEMESNGSATPKSRRHPLTLPXDWWDSAR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |