| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002019 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0103013 | Gp0060265 | Ga0016710 |
| Sample Name | Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot1-3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 13365584 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Clay → Grasslands → Switchgrass Rhizosphere And Bulk Soil → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | grassland biome → land → bulk soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Knoxville, Tennessee, USA | |||||||
| Coordinates | Lat. (o) | 35.9728 | Long. (o) | -83.9422 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007321 | Metagenome / Metatranscriptome | 353 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| plot13_105317 | Not Available | 512 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| plot13_105317 | plot13_1053172 | F007321 | MRARTLQTWIARHILVRRRLESICTSYLLFLMVVTTKHSLEEAARFSGLHKSQFSKMLKGHRDVAVST |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |