Sample 3300001925

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001925

3300001925: Marine microbial communities from the Tropical South Pacific Ocean - GS041

Overview

Basic Information
IMG/M Taxon OID	3300001925 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0055716 \| Gp0056503 \| Ga0016841
Sample Name	Marine microbial communities from the Tropical South Pacific Ocean - GS041
Sequencing Status	Permanent Draft
Sequencing Center	J. Craig Venter Institute (JCVI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	494549
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities From Global Ocean Sampling (Gos)
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	South Pacific Ocean
Coordinates	Lat. (^o)	-5.93	Long. (^o)	-108.68694	Alt. (m)	N/A	Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045145	Metagenome / Metatranscriptome	153	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
GOS2256_10120	All Organisms → Viruses → Predicted Viral	1403	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
GOS2256_10120	GOS2256_101202	F045145	MDKDKLKIIVSDLELLLSALKAEVYADTESYRYSDLDPVELDYDDEFEGT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.