| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001881 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095509 | Gp0056883 | Ga0004713 |
| Sample Name | Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 198477119 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Type | Engineered |
| Taxonomy | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Espanola, New Mexico, United States | |||||||
| Coordinates | Lat. (o) | 35.992 | Long. (o) | -106.0797 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049012 | Metagenome / Metatranscriptome | 147 | Y |
| F079376 | Metagenome / Metatranscriptome | 116 | Y |
| F089576 | Metagenome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI24728J21555_1005963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4000 | Open in IMG/M |
| JGI24728J21555_1010028 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | 2842 | Open in IMG/M |
| JGI24728J21555_1061470 | Not Available | 627 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI24728J21555_1005963 | JGI24728J21555_10059635 | F079376 | MSDIGNTRQPGRPCVSFGVSRVCRTTEKGGRQTRHRGSDSLVVPVKVGNAAGGKEATYGSAE* |
| JGI24728J21555_1010028 | JGI24728J21555_10100282 | F089576 | MFGLPDITVAVVGGVVLVILAALVYWGLTFRGHD* |
| JGI24728J21555_1061470 | JGI24728J21555_10614701 | F049012 | QCQDKTKHVEKRFLLCXXXYLDEYXTKXRIVLSDSCDFDVFCHFIDFLVSGCIPSDRNDQIGVINLLREWESHFGIVDGFRFRLCCQEKDGIVVYNGDKYEVNIGCLLFHSEVFREFYKNSCGMVFNFDSSYSRESFEVFLDLIHNRISYPSVEKAGDVYDIXNCLHCDSLCQLLNDDSSERVLSLLIQNQSDSIDFSKYERSITQKI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |