NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001548

3300001548: Estuarine microbial mat communities from Elkhorn Slough, California, USA - CR1B Metatranscriptome (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300001548 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053052 | Gp0054726 | Ga0001195
Sample NameEstuarine microbial mat communities from Elkhorn Slough, California, USA - CR1B Metatranscriptome (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size8678212
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEstuarine Microbial Mat Communities From Elkhorn Slough, Moss Landing, Ca, That Are H2-evolving And Photosynthetic
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Mat Communities From Elkhorn Slough, Moss Landing, Ca, That Are H2-evolving And Photosynthetic

Alternative Ecosystem Assignments
Environment Ontology (ENVO)estuarine biomeestuaryestuarine water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationElkhorn Slough, Moss Landing, CA
CoordinatesLat. (o)36.8Long. (o)-121.8Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060086Metagenome / Metatranscriptome133Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12189J15679_108889Not Available782Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12189J15679_108889JGI12189J15679_1088892F060086PFELDSNLLLSSGRHGEDRKRQYLYDHETPLLDDLADLLY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.