NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001455

3300001455: Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2



Overview

Basic Information
IMG/M Taxon OID3300001455 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0071004 | Gp0053798 | Ga0002402
Sample NameForest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12215134
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → Acidiferrobacter thiooxydans1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Multiple Locations In Canada And Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → solid layer → forest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationEl Dorado National Forest, Georgetown, California, USA
CoordinatesLat. (o)38.88Long. (o)-120.64Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002875Metagenome / Metatranscriptome524Y
F005285Metagenome / Metatranscriptome406Y
F016023Metagenome / Metatranscriptome250Y
F033929Metagenome / Metatranscriptome176Y
F053353Metagenome / Metatranscriptome141N
F055043Metagenome / Metatranscriptome139Y
F081571Metagenome / Metatranscriptome114Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI11848J15208_100013Not Available2658Open in IMG/M
JGI11848J15208_100430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1042Open in IMG/M
JGI11848J15208_100926All Organisms → cellular organisms → Bacteria741Open in IMG/M
JGI11848J15208_101249All Organisms → cellular organisms → Bacteria → Proteobacteria664Open in IMG/M
JGI11848J15208_101916All Organisms → cellular organisms → Bacteria576Open in IMG/M
JGI11848J15208_102673All Organisms → cellular organisms → Bacteria513Open in IMG/M
JGI11848J15208_102708All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → Acidiferrobacter thiooxydans512Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI11848J15208_100013JGI11848J15208_1000132F033929MPRGILSRRSDTGQTSWGKLSRLPRTVAESTLRIFDGYGLRGTLPARPMLAPCIRFLSIDSRVCSMLPSDTASRR*
JGI11848J15208_100430JGI11848J15208_1004302F002875MRGLKVAILMAATAWAGTAMSADDAFRQAVNYVFSGNVAGKTPQLLSSIVDETKCIISVEMPGNSWLYYLKEVRPDSIIIDENNGKISFEGDSTIVEHTFESLPRVDKDNKISITLRGEVERTRDALKLIFTKYCLPKSG*
JGI11848J15208_100926JGI11848J15208_1009261F005285LESTVSRRIGMHGVSGDGMARRWSEMNQGSRTGKGTAFMAARGPEELSPGGDRAFVVARKRGNARGAKGGRKVEA*
JGI11848J15208_101249JGI11848J15208_1012491F055043RSDAAKAQLEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP*
JGI11848J15208_101916JGI11848J15208_1019162F016023MTDRIIVATFNDTNAAYDAASAIKGLKDAGVADFKLKTGVMIKKDDRGNVVLLESK
JGI11848J15208_102673JGI11848J15208_1026731F053353QILRKVARSTELSRGDIATEAKLAVGYYVYTISVAGVVRYIGKGKGLRLYSHMKEVRSRLKRDFRVQSIGSILQRNLTKAFLSEAQVTEQVLIDDLTEKAAYKLEYDKLREYVFAGKGDQLWNVIPASIQTPQEIQAYTERLQRNLNSRDRWVRTLSAMTLEALRGGQHQH
JGI11848J15208_102708JGI11848J15208_1027081F081571KRVFVESSGRLWGLMLEKAVHCLGILHYGWAWNLASKMDGTSSEAKPTALGYVFVPWFSTGTNSARDFR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.