| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001438 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0090294 | Gp0057738 | Ga0012465 |
| Sample Name | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3208132 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Kellogg Biological Station, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004014 | Metagenome / Metatranscriptome | 457 | Y |
| F070666 | Metagenome / Metatranscriptome | 123 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI24035J14997_100077 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 748 | Open in IMG/M |
| JGI24035J14997_100120 | Not Available | 654 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI24035J14997_100077 | JGI24035J14997_1000772 | F004014 | MRKAHLCGCAVLLLFCAPSFAQENSRSGSAKEDAPKVIATDDMKLAMKAGKLETAGKYDEALKVYAQAIDLKGRFTPFVYHNRGMLYLQRAKAAQDRQSRIADLQHAIDDFQTSIRLGAASKEELN |
| JGI24035J14997_100120 | JGI24035J14997_1001201 | F070666 | VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSRCRIRGARQHPAAIHLTVEAST |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |