Basic Information | |
---|---|
IMG/M Taxon OID | 3300001320 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0083722 | Gp0055459 | Ga0011178 |
Sample Name | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-65cm)- 6 month illumina |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Tennessee |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 12063965 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → active permafrost layer → permafrost |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Axel Heiberg Island, Nunavut, Canada | |||||||
Coordinates | Lat. (o) | 79.26 | Long. (o) | -90.46 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015243 | Metagenome / Metatranscriptome | 256 | Y |
F046558 | Metagenome | 151 | Y |
F104112 | Metagenome / Metatranscriptome | 101 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
A2865W6_115749 | Not Available | 601 | Open in IMG/M |
A2865W6_120068 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
A2865W6_122654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
A2865W6_115749 | A2865W6_1157491 | F104112 | EWRFHEHCTSAIDEADDSLRAVMWQIAMGVVSKTDENENFIVEACGQPNMKMARHFLXXXXQWGERRKRHVPHNAGVLVIGGDVTKKPEYDTTASVKARKWKSFSRKFREAKT* |
A2865W6_120068 | A2865W6_1200681 | F046558 | MPSLVGSEMCIRDRIGPTQFVQLPVQLSGTLMGDSLIVETDSVAEKCSSVSSALLADLHNLLIRFPTPVSQGSGWRNSVELKACQGMIPTTSRITRSYIVSGEIAYQGDLVLVVQRTDSIQAHGEGAQQQHPLTLDAKGTGNAVYYVSPRDGRIVRLNTEQDLDPVSYT |
A2865W6_122654 | A2865W6_1226541 | F015243 | RNLMKKLFGPRGIPGADSTTLKKETKLAKINATDLGSAKPRARRTVGLTEQRLRAANKQSWMTSTKGWSDFLGRFTWSSKG* |
⦗Top⦘ |