| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001320 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0083722 | Gp0055459 | Ga0011178 |
| Sample Name | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-65cm)- 6 month illumina |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Tennessee |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 12063965 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → active permafrost layer → permafrost |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Axel Heiberg Island, Nunavut, Canada | |||||||
| Coordinates | Lat. (o) | 79.26 | Long. (o) | -90.46 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015243 | Metagenome / Metatranscriptome | 256 | Y |
| F046558 | Metagenome | 151 | Y |
| F104112 | Metagenome / Metatranscriptome | 101 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| A2865W6_115749 | Not Available | 601 | Open in IMG/M |
| A2865W6_120068 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| A2865W6_122654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| A2865W6_115749 | A2865W6_1157491 | F104112 | EWRFHEHCTSAIDEADDSLRAVMWQIAMGVVSKTDENENFIVEACGQPNMKMARHFLXXXXQWGERRKRHVPHNAGVLVIGGDVTKKPEYDTTASVKARKWKSFSRKFREAKT* |
| A2865W6_120068 | A2865W6_1200681 | F046558 | MPSLVGSEMCIRDRIGPTQFVQLPVQLSGTLMGDSLIVETDSVAEKCSSVSSALLADLHNLLIRFPTPVSQGSGWRNSVELKACQGMIPTTSRITRSYIVSGEIAYQGDLVLVVQRTDSIQAHGEGAQQQHPLTLDAKGTGNAVYYVSPRDGRIVRLNTEQDLDPVSYT |
| A2865W6_122654 | A2865W6_1226541 | F015243 | RNLMKKLFGPRGIPGADSTTLKKETKLAKINATDLGSAKPRARRTVGLTEQRLRAANKQSWMTSTKGWSDFLGRFTWSSKG* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |