NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001010

3300001010: Marine microbial communities from South of Eden, South Pacific Ocean - MP1434



Overview

Basic Information
IMG/M Taxon OID3300001010 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054678 | Ga0000783
Sample NameMarine microbial communities from South of Eden, South Pacific Ocean - MP1434
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6742179
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth of Eden, South Pacific Ocean
CoordinatesLat. (o)-38.64Long. (o)150.41Alt. (m)N/ADepth (m)4001.15
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010197Metagenome307Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI11983J13109_101341Not Available593Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI11983J13109_101341JGI11983J13109_1013411F010197LLFDGLNLFLLPNTTHKLKAFTIKHDFAQHMQKVFSRQDGILFSFEEV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.