Sample 3300000954

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000954

3300000954: Marine sediment microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1

Overview

Basic Information
IMG/M Taxon OID	3300000954 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053056 \| Gp0053374 \| Ga0001432
Sample Name	Marine sediment microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	170874585
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine benthic biome → marine benthic feature → marine sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Cabo Rojo, Puerto Rico
Coordinates	Lat. (^o)	17.951083	Long. (^o)	-67.193167	Alt. (m)	N/A	Depth (m)	.05
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102576	Metagenome	101	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
JGI1689J12820_1000125	All Organisms → cellular organisms → Bacteria	13360	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI1689J12820_1000125	JGI1689J12820_100012512	F102576	VENLLKLEEYFPGGELMGGIELANRMDWGLSLQLSGEDWVVSSGGEPIYTTDCKESLQSFVYGLGLAYAVLPRKLFDELVDNVRNL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.