NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000944

3300000944: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY81



Overview

Basic Information
IMG/M Taxon OID3300000944 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085351 | Gp0056476 | Ga0011769
Sample NameMacroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY81
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size331353260
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMacroalgal Surface Microbial Communities
TypeHost-Associated
TaxonomyHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationBotany Bay, Sydney, NSW, Australia
CoordinatesLat. (o)-33.966629Long. (o)151.166614Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042355Metagenome / Metatranscriptome158Y
F071374Metagenome / Metatranscriptome122Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
BBAY81_10041525Not Available870Open in IMG/M
BBAY81_10063943Not Available632Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
BBAY81_10041525BBAY81_100415252F071374MSIDEAYEWLKGNRSMTNVIPDEPRETWVVRVAQADAALTQQAYWIVKAHKEGLNNEDR*
BBAY81_10063943BBAY81_100639432F042355MSSDLKQLNKIKKNSRRTNTVQKPRLVERLIKISRVSKVTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.