Basic Information | |
---|---|
IMG/M Taxon OID | 3300000934 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045862 | Gp0056057 | Ga0011752 |
Sample Name | Sinkhole freshwater microbial communities from Lake Huron, USA - r2gDNA Day1 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Michigan |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 24002010 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater lake biome → sinkhole → fresh water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Middle Island Sinkhole, Lake Huron Michigan, USA | |||||||
Coordinates | Lat. (o) | 45.19843 | Long. (o) | -83.32721 | Alt. (m) | N/A | Depth (m) | 23 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001506 | Metagenome / Metatranscriptome | 681 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
KEY_100066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 40562 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
KEY_100066 | KEY_10006628 | F001506 | MNRILYENRCRCNEDFSITKKRKSPNRSEGKPLQYPKPNEITSKTFQIKYHDKLSLTAKFILNSFQNKYIYYAIDDILYTLKASPIERDNLLAILYSPVLSLQNNFSVNFFDIWIRQVYIEEISKTNKFLSNDSQALNLNQFTYITIQFFYKTRVPVKKQESLW* |
⦗Top⦘ |