NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000892

3300000892: Marine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 2



Overview

Basic Information
IMG/M Taxon OID3300000892 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053056 | Gp0053725 | Ga0000194
Sample NameMarine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size67889334
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea3
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnvironmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomepondsediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEden Landing Ponds, San Francisco, CA, USA
CoordinatesLat. (o)37.569017Long. (o)-122.102433Alt. (m)N/ADepth (m).11
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024682Metagenome / Metatranscriptome205Y
F028081Metagenome / Metatranscriptome192Y
F038920Metagenome / Metatranscriptome165Y
F058721Metagenome / Metatranscriptome134Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI1678J12821_1000360All Organisms → cellular organisms → Archaea2781Open in IMG/M
JGI1678J12821_1002711All Organisms → cellular organisms → Archaea1579Open in IMG/M
JGI1678J12821_1005353All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1226Open in IMG/M
JGI1678J12821_1010767All Organisms → cellular organisms → Archaea905Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI1678J12821_1000360JGI1678J12821_10003601F028081MDKEKALQKLQKTRNENEQAYLKAKAFLEGFRARGQLSKKDNEFLFLLEFVIKGFKNHGNDIITAFENQVRFTEAFNNLQAKVNDLEHDIRQLRKTLDKMYQDR*
JGI1678J12821_1002711JGI1678J12821_10027113F058721MLKTTLPCADPQCADKMRLVFQNERFLGYRCLLKPKSHNFRYDIERKRWEKIIIKTKPIIGYKKSPYDVALDEDVAIETI*
JGI1678J12821_1005353JGI1678J12821_10053533F024682LSAEDELISKLKEEIGKTVPPMFAEIAKDMMEKNKEVIINLLKDNKNLVKEVIES*
JGI1678J12821_1010767JGI1678J12821_10107672F038920LLTEILTDQQLIDLYTTPGYLVAVDYPKKEIKLHMVDCMLADPISSVGVKPSKARENKTGEFWFSESREEANSKAEEIAKNKEYTYKICPICNR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.