| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000704 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0075432 | Gp0054384 | Ga0001932 |
| Sample Name | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 9 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 9942666 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → tropical forest → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Luquillo Experimental Forest Soil, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.0 | Long. (o) | -65.0 | Alt. (m) | N/A | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002998 | Metagenome / Metatranscriptome | 514 | Y |
| F012695 | Metagenome / Metatranscriptome | 278 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12542J11869_100757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 930 | Open in IMG/M |
| JGI12542J11869_101538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12542J11869_100757 | JGI12542J11869_1007571 | F012695 | MLEGVRQALEEMLAAKNVKATVKAAPTSGVGPQKLTAMNFSVVSPAVRIGRIQMIGVSPAMQAKASLLVNGQTGNSFDTENTAIGLQHAFEELYQDQGYAAVQVSVGQIDPIAVSEQFVDIPYAVMIQEGGLYKLGSIDLPAGMLVARADVERMRAKYPVGSGRPLDLFLQAVRDAYHAIGYLDCSVAPRAAFNETTHVVNYSLDITPGPQYRFASVKFDGAPEAMAGKLKLAWKMAPGDAFDESYLANFAALAQKKDKAMTKWLLTVLTTYDVKADPATHEVNCIFHFAKPAQSAR* |
| JGI12542J11869_101538 | JGI12542J11869_1015382 | F002998 | MSISVNRVWRQLPDEIRVAACKIFWAESKGAEKQFLFTALARAKNLRETFVRKTSTERLVNWTATTLSLPDPLVEDLLKQYLLHDHRGVIISFLELLKIPHSEGMIEENFDYTTLTKESVQEAARNLLASADRTGAELYLQYLVLQGDPWTGVEEVL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |