| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000511 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053056 | Gp0053347 | Ga0000191 |
| Sample Name | Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 53433178 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → pond → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Alviso Ponds, San Francisco, CA, USA | |||||||
| Coordinates | Lat. (o) | 37.475383 | Long. (o) | -121.9729 | Alt. (m) | N/A | Depth (m) | .09 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038111 | Metagenome | 166 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| P_A23_Sed_1_FmtDRAFT_1005025 | Not Available | 1422 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| P_A23_Sed_1_FmtDRAFT_1005025 | P_A23_Sed_1_FmtDRAFT_10050251 | F038111 | PCPSFYYEAMIPSKVAVANKPEYTIWLENYKNIATFIHADVYKYNKTIRQEFGKDLNLLANLHNSPLYVLTHKDNKKLKKFMSIYGLVLDHTPLCDDGIEREVYRLDRRQ* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |