Sample 3300000495

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000495

3300000495: Lentic microbial communities from White Lake grasslands, BC, Canada

Overview

Basic Information
IMG/M Taxon OID	3300000495 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0074126 \| Gp0054485 \| Ga0011521
Sample Name	Lentic microbial communities from White Lake grasslands, BC, Canada
Sequencing Status	Permanent Draft
Sequencing Center	Pennsylvania State University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	22541773
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Lentic Microbial Communities From White Lake Grasslands, Bc, Canada
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From White Lake Grasslands, Bc, Canada

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater lake biome → freshwater lake → lake water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	White Lake grasslands, BC, Canada
Coordinates	Lat. (^o)	49.2833	Long. (^o)	-119.5833	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082368	Metagenome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
ML7_108444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	758	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
ML7_108444	ML7_1084442	F082368	MEIELWTLFDALMKWVIIPMAAMLWVHNQKIGAHEKEVLRIMTLLSERKDQRDEDRAELKEALRDLRAAILRLDQRLADFALAQSAQTPAPEPTRQTASRRAKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.