Sample 3300000451

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000451

3300000451: Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3

Overview

Basic Information
IMG/M Taxon OID	3300000451 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0071004 \| Gp0054307 \| Ga0011531
Sample Name	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	1029583
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Forest Soil Microbial Communities From Multiple Locations In Canada And Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	forest biome → solid layer → forest soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	El Dorado National Forest, Georgetown, California, USA
Coordinates	Lat. (^o)	38.88	Long. (^o)	-120.64	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022892	Metagenome / Metatranscriptome	212	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
MB_CA_OM1_O3DRAFT_10006	All Organisms → cellular organisms → Eukaryota	4614	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
MB_CA_OM1_O3DRAFT_10006	MB_CA_OM1_O3DRAFT_100061	F022892	MKPKVNNIGVLILTDPPQAVANQEKILIAVGTAMIIVALVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.