NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000409

3300000409: Marine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 1



Overview

Basic Information
IMG/M Taxon OID3300000409 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053056 | Gp0053724 | Ga0026676
Sample NameMarine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 1
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size24779847
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnvironmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomepondsediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEden Landing Ponds, San Francisco, CA, USA
CoordinatesLat. (o)37.569167Long. (o)-122.1019Alt. (m)N/ADepth (m).13
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048391Metagenome / Metatranscriptome148Y
F052283Metagenome / Metatranscriptome143Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
P_2C_Sed_1_UnCtyDRAFT_100888All Organisms → cellular organisms → Bacteria1493Open in IMG/M
P_2C_Sed_1_UnCtyDRAFT_106056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales593Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
P_2C_Sed_1_UnCtyDRAFT_100888P_2C_Sed_1_UnCtyDRAFT_1008882F052283MNSRQKSVFTGAILGAALGAVGGYLFTRGLDLSREGREQPDELSLKSVPPGEMVKVFIAIMAVLRGIAELGERL*
P_2C_Sed_1_UnCtyDRAFT_106056P_2C_Sed_1_UnCtyDRAFT_1060561F048391SVEPINTLDYLNELLGKGYVIKGPRKDSSRDLISFKAFLKKGKEFAPEGWLLHMGYEFIEPNTFTKGHKIAYKIIDEIPDERFNSNYTLVKENREIPLYLKVAVLKAE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.