| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000337 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063124 | Gp0053524 | Ga0026151 |
| Sample Name | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - metatranscriptome cDNA-P3 |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 306555 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → solid layer → permafrost |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bonanza creek, Alaska, USA | |||||||
| Coordinates | Lat. (o) | 64.7 | Long. (o) | -148.3 | Alt. (m) | N/A | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005001 | Metagenome / Metatranscriptome | 415 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| permaP3DRAFT_10026 | Not Available | 596 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| permaP3DRAFT_10026 | permaP3DRAFT_100261 | F005001 | NCNTTHYRGQVT*FPAWLSTGMHGMEHREQERRTFRLSAPRWPFSPASGSMLPGSPLAASCPEPVARNGFLLAHNGCRLSATSIPGSKLPACYFASFQVXFRARSALRLHCRVPVCAGCGGFTASGPLHFHHSVRPAAPAISTPLRDSYIPRDQSVQPPLLPAGPPGVSARFPLAPRRPS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |