NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000144

3300000144: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1000m



Overview

Basic Information
IMG/M Taxon OID3300000144 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046785 | Gp0054025 | Ga0026199
Sample NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1000m
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17957835
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine aphotic zonesea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationP4, Pacific Ocean
CoordinatesLat. (o)48.65Long. (o)-126.666667Alt. (m)N/ADepth (m)1000
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100407Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
LPjun08P41000mDRAFT_c100010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes10235Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
LPjun08P41000mDRAFT_c100010LPjun08P41000mDRAFT_10001013F100407MTRPYYISATIIPLFYSLIGVIFLFAPEIPSTDISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.