Sample 3300000144

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000144

3300000144: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1000m

Overview

Basic Information
IMG/M Taxon OID	3300000144 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0046785 \| Gp0054025 \| Ga0026199
Sample Name	Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1000m
Sequencing Status	Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	17957835
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine aphotic zone → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	P4, Pacific Ocean
Coordinates	Lat. (^o)	48.65	Long. (^o)	-126.666667	Alt. (m)	N/A	Depth (m)	1000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100407	Metagenome / Metatranscriptome	102	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
LPjun08P41000mDRAFT_c100010	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	10235	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
LPjun08P41000mDRAFT_c100010	LPjun08P41000mDRAFT_10001013	F100407	MTRPYYISATIIPLFYSLIGVIFLFAPEIPSTDISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.