NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2236876022

2236876022: Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - DCM



Overview

Basic Information
IMG/M Taxon OID2236876022 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0050867 | Gp0052623 | Ga0011308
Sample NameSaline water concentrator pond microbial communities from Bras del Port saltern, Spain - DCM
Sequencing StatusPermanent Draft
Sequencing CenterGATC-Biotech AG, Konstanz, Germany
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size290618382
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Haptista1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomesaline evaporation pondsaline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Hypersaline (saline)

Location Information
LocationSpain: Bras del Port
CoordinatesLat. (o)38.1875529Long. (o)-0.6338098Alt. (m)N/ADepth (m)3010
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030973Metagenome / Metatranscriptome183Y
F046986Metagenome150Y
F097516Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
DCM3_p0013975Not Available534Open in IMG/M
DCM3_p0048888All Organisms → cellular organisms → Eukaryota → Haptista502Open in IMG/M
DCM3_p0935928Not Available534Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
DCM3_p0013975DCM3_00139751F046986KMSARFNISIRTGHDDYKRAMQLLREEQQGTREELLNQLQALRLATVQRALKRGHYQTVATLLGDMGRVIGEAAPEQLALQVPTLDIRIENENQSQ
DCM3_p0048888DCM3_00488881F030973MYQKRMQGEWNAGMLGSRNYSAVRLSEGRHWKGNLYGTTINDQHQGHRNYDCPHIFSKGPEPKFENMDHAMKHKSVYLGFYGN
DCM3_p0935928DCM3_09359281F097516MVINSQLAPCQQSYRITLDLTVTEDFNPHQIDFRRVFDLSEWESINTHIEEL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.