x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 2199352026
2199352026: Bovine rumen microbial communities from Vernon, TX, USA, Sample 669
Overview
| Basic Information |
| IMG/M Taxon OID | 2199352026 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0046171 | Gp0052340 | Ga0011127 |
| Sample Name | Bovine rumen microbial communities from Vernon, TX, USA, Sample 669 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Texas A and M University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 26083354 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Bovine Rumen Microbial Communities From Vernon, Tx, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Microbial Communities From Vernon, Tx, Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information |
| Location | Vernon, Texas |
| Coordinates | Lat. (o) | 34.154 | Long. (o) | -99.264 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F081939 | Metagenome / Metatranscriptome | 114 | N |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| rumenmetagenome__Contig_4166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella | 4078 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| rumenmetagenome__Contig_4166 | rumenmetagenome_00057000 | F081939 | MLADKLNEAIESCNFEPTEELDLFAEAVALLIAYWGKVSDWTPIEKASYVGYVTTTVMEKGLDVAIKDFDEYRKSLNTKFGN |
