| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2162886008 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063182 | Gp0052032 | Ga0026247 |
| Sample Name | Soil microbial communities from Puerto Rico rain forest, that decompose switchgrass - Feedstock-adapted consortia SG + Fe |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 154120208 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Puerto Rico Rain Forest, That Decompose Switchgrass |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Soil → Soil Microbial Communities From Puerto Rico Rain Forest, That Decompose Switchgrass |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → tropical forest → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Luquillo LTER tropical forest, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.3724 | Long. (o) | -65.7166 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088999 | Metagenome / Metatranscriptome | 109 | Y |
| F096286 | Metagenome | 105 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| PRSSGFe2_Sequence0000001033 | All Organisms → cellular organisms → Bacteria | 12852 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| PRSSGFe2_Sequence0000001033 | PRSSGFe2_0033.00001310 | F096286 | VNRRRVKTVRLKHEHSALIDPSMKGKKVDHIRFSQAERSIVYVSVVFDDRTEWSIAIESFSLPTARVSHFVTIEEDPIAETGLMFLPDDSSSYPQFDQIQQPPKQRKPSKKSKK |
| PRSSGFe2_Sequence0000001033 | PRSSGFe2_0033.00001350 | F088999 | MNNKLLLMLCAFLAVAVSATAQETSDKFAIFVTGVGDATPVAQSLVKKLNASKPFEVVSKNDIAKVVVLVSCSSRKQTDPFLCMYVAHFNGPAFKTFLGGGMWAATNADAVSDNFLASIAQDIVERFDSTSKENLREALQACLLMTDSKCNVPDPLQKEFDAKQLTLGQYLLKKNQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |