NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2077657001

2077657001: Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B3



Overview

Basic Information
IMG/M Taxon OID2077657001 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046169 | Gp0051734 | Ga0011066
Sample NameSulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B3
Sequencing StatusPermanent Draft
Sequencing CenterMogene LC
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size39374125
Sequencing Scaffolds9
Novel Protein Genes10
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria5
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
Not Available1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSulfur Spring Sediment And Crust Microbial Communities From Zodletone, Oklahoma, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Warm (34-42C) → Sediment → Sulfur Spring Sediment And Crust → Sulfur Spring Sediment And Crust Microbial Communities From Zodletone, Oklahoma, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → sulfur spring → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Surface (non-saline)

Location Information
LocationSouthwest Oklahoma
CoordinatesLat. (o)35.100293Long. (o)-98.749601Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000203Metagenome / Metatranscriptome1619Y
F035850Metagenome / Metatranscriptome171Y
F037503Metagenome / Metatranscriptome168Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
ZODLETONE_B3_GLDH0LQ03F49DDAll Organisms → cellular organisms → Bacteria526Open in IMG/M
ZODLETONE_B3_GLDH0LQ03FJRFIAll Organisms → cellular organisms → Bacteria501Open in IMG/M
ZODLETONE_B3_GLDH0LQ03G6D6YAll Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium524Open in IMG/M
ZODLETONE_B3_GLDH0LQ03GGTJQAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
ZODLETONE_B3_GLDH0LQ03GKXDGAll Organisms → cellular organisms → Bacteria559Open in IMG/M
ZODLETONE_B3_GLDH0LQ03GM67ENot Available553Open in IMG/M
ZODLETONE_B3_GLDH0LQ03GPPVQAll Organisms → cellular organisms → Bacteria541Open in IMG/M
ZODLETONE_B3_GLDH0LQ03GU95BAll Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides515Open in IMG/M
ZODLETONE_B3_GLDH0LQ03GV5UMAll Organisms → cellular organisms → Bacteria521Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
ZODLETONE_B3_GLDH0LQ03F49DDZODLETONE_00807700F037503VSVVVIVIEVELLIGLGGFTAYQTLTNSECYNIYTAVRAWVLRSMSERERTQIIS
ZODLETONE_B3_GLDH0LQ03F780TZODLETONE_00402140F000203DTYVRHALFPVPTLGALQAAGFPTLFSTASGVIGLVAGPSSASRQLDY
ZODLETONE_B3_GLDH0LQ03FJRFIZODLETONE_00555790F037503MPLGAASWLSVIEVELPIGCEGFTTYQSLTNSECYNIYTGVRRWVLRSGAERERTIRG
ZODLETONE_B3_GLDH0LQ03G6D6YZODLETONE_01072650F037503MHLGAASRSSVIEVELLIRLEGFTAYQTLINSKCYDIYSGVRAWVLRSVSERETTQIIS
ZODLETONE_B3_GLDH0LQ03GGTJQZODLETONE_01044930F035850ELGDPMLPRKASREVLAARTPNRSGGQVENTKAIER
ZODLETONE_B3_GLDH0LQ03GKXDGZODLETONE_00018060F035850MPPRKASREVGRARTKTDTGGQVEKTKAIGRTLVKELGKMAP
ZODLETONE_B3_GLDH0LQ03GM67EZODLETONE_00676730F035850MLEEGDPMLPRKASREVLAARTLTDSGGQVENTKAIEIIVVKELG
ZODLETONE_B3_GLDH0LQ03GPPVQZODLETONE_00198620F037503MPLGAASRWSHVEVELPIGLGGVTSYRILTNSECHLIYAAVRLGVLRSRAERERTQTAS
ZODLETONE_B3_GLDH0LQ03GU95BZODLETONE_00778890F037503VVSLAEVELLIRLEGFTAYQPLTNSEYCKIYTGVSPRVLRSVDKRERTQTIS
ZODLETONE_B3_GLDH0LQ03GV5UMZODLETONE_00373060F037503TLLVQTKRYLVLPEMHLGAASWLSLIEVELLIGLEGFTAYQTLTNSECYKIYTGVRAWVLRSMSERETTRTIS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.