Sample 2017108002

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 2017108002

2017108002: Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment

Overview

Basic Information
IMG/M Taxon OID	2017108002 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0045254 \| Gp0051386 \| Ga0025779
Sample Name	Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment
Sequencing Status	Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	20878222
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands
Type	Engineered
Taxonomy	Engineered → Wastewater → Nutrient Removal → Nitrogen Removal → Anammox → Bioreactor → Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Nijmegen, The Netherlands
Coordinates	Lat. (^o)	51.842	Long. (^o)	5.858	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061392	Metagenome / Metatranscriptome	132	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
MAnammo_C2172	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae	8539	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
MAnammo_C2172	MAnammox_158480	F061392	MPLQTFASGLDEPDPAFKLAAALSPIDGGELYVGNVDRDKKTFRLHLRHIGKNSKWVYYYASASAFVNEDGDVEPDNAVASLVYPQYTASVIGNTFRKARVRILFSPRGDGKGFFKEAGHVIFQECATKTFEAKNWKCTGWEYLGTLPGFE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.