| Basic Information | |
|---|---|
| Taxon OID | 3300034124 Open in IMG/M |
| Scaffold ID | Ga0370483_0001509 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6421 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Alaska | |||||||
| Coordinates | Lat. (o) | 64.9123 | Long. (o) | -147.839 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003084 | Metagenome / Metatranscriptome | 508 | Y |
| F005823 | Metagenome / Metatranscriptome | 389 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0370483_0001509_2486_2761 | F005823 | GAGG | MRNLPSKFVSPSVTIRVAGSLSEGHLAYLDQLIAAAIECALWPLLDLAYLKEMDQDALRYLVAGEGRHFGIVSCPDLIREWMQLEKERPAA |
| Ga0370483_0001509_5400_6053 | F003084 | GGAGG | MSGKQAVLAVLVVGICMLGRTAAAQDEKNELTGMLGRIFISDQGIHGANVPSINPFVRSGKGLTFEIDYARHFAGNEIYSLSLEVPAVFNVDEDLGSGGDVVPSGYRQIFVTPALRVNLFPETKVSPWVSIGGGFAHFSESSNLIYYGTNPGGSTNSGVLQAGIGLDVYPFCRRMRHFGVRGEVRDFWSGTPDLPLADTGKTRQHNYFLAGGMTWHF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |