| Basic Information | |
|---|---|
| Taxon OID | 3300034121 Open in IMG/M |
| Scaffold ID | Ga0335058_0002150 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 13658 |
| Total Scaffold Genes | 20 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (70.00%) |
| Novel Protein Genes | 3 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Associated Families | 3 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.0995 | Long. (o) | -89.4045 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000763 | Metagenome / Metatranscriptome | 901 | Y |
| F012870 | Metagenome / Metatranscriptome | 276 | Y |
| F019137 | Metagenome / Metatranscriptome | 231 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0335058_0002150_12459_12593 | F000763 | GGAG | MKNPVYLAAGAFLAAWSATNFSTDYRAILWSVLSGVFGYATPKK |
| Ga0335058_0002150_6164_6271 | F012870 | GGAG | MTELEQWEKENEAFLIKIGQVKPVAFKPVTKKDEE |
| Ga0335058_0002150_6707_6964 | F019137 | AGG | MAKLKIVRTDGSTVEGEITPAVEYAFEIHAKKGFHRAFREDEKQSDIFFLAWEVLRRSGETVKPFGMEFIETLSSVSVLDSEPLS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |