NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335036_0039321

Scaffold Ga0335036_0039321


Overview

Basic Information
Taxon OID3300034106 Open in IMG/M
Scaffold IDGa0335036_0039321 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3677
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (86.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002827Metagenome / Metatranscriptome527Y
F006743Metagenome / Metatranscriptome365Y
F052570Metagenome / Metatranscriptome142N

Sequences

Protein IDFamilyRBSSequence
Ga0335036_0039321_120_413F006743GGAGGMRTENWQSNTRGLRLVGEGESGSAFTFFGPVRAGLTTSQATSKEAQLSELLKCLEREVENLRSKYCEAYVTLISVTEHLVRLNALLLNTDTTKLKDS
Ga0335036_0039321_1691_1858F002827AGGAGMNKEYYQAKADLCRDLAIKQMVEGEAGEAGKNLIRMVNALNQINLINYKEEKDNE
Ga0335036_0039321_2615_3019F052570GGAGGMKYKLPKGVELEILDYDAERKDRQDSAFYTWGDTSDVALLTYEGREYRVVCVGEMRILYKGEIIRYCDDLVRAGIKRDKDLSKIDDSGGEWINNSWFEVIDEGSNEYTGEVYHEVKDAIETVANWIVDKELVNV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.