| Basic Information | |
|---|---|
| Taxon OID | 3300034091 Open in IMG/M |
| Scaffold ID | Ga0326724_0272068 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 958 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York | |||||||
| Coordinates | Lat. (o) | 42.5488 | Long. (o) | -76.2662 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015428 | Metagenome | 254 | Y |
| F047437 | Metagenome / Metatranscriptome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326724_0272068_464_757 | F015428 | N/A | MGSGIGFLLRWRNRLLASKVNYFRPPHNRKSPFDKLVRSGTGPVITRQDQLSVKLADGLTVLVRRLVMLDAFRQLMRALALPHSPLRRRLRGQRRLL |
| Ga0326724_0272068_90_416 | F047437 | AGGTGG | VAASEAAQGHEANRLPPGSREFKTLFDGVVRKVQEYSAESGDPLYTLQARLPALCALERLAYPAPAVPRNKAGLTLGIFIAALLGSLGMGALIGLGAGMAHCIARLFG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |